SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402689 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402689
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000759
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402689   Gene: ENSG00000175193   Transcript: ENST00000450375
Sequence length 63
Comment pep:putative chromosome:GRCh38:3:183829390:183842394:-1 gene:ENSG00000175193 transcript:ENST00000450375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGAMVCY
LRS
Download sequence
Identical sequences H7C1V6
ENSP00000402689 ENSP00000402689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]