SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402955 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000402955
Domain Number - Region: 10-41
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0112
Family Di-heme elbow motif 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402955   Gene: ENSG00000115750   Transcript: ENST00000416181
Sequence length 57
Comment pep:known chromosome:GRCh38:2:9843527:9849407:1 gene:ENSG00000115750 transcript:ENST00000416181 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTEYLTDYKVFGSIISFPPHH
Download sequence
Identical sequences F8WDU0
ENSP00000402955 ENSP00000402955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]