SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403025 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403025
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000265
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 68-126
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000427
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403025   Gene: ENSG00000237046   Transcript: ENST00000421981
Sequence length 229
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:30182139:30193864:1 gene:ENSG00000237046 transcript:ENST00000421981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNR
RSRKLRKDIAELQRLKAQQEKKLQALQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDL
ERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL
Download sequence
Identical sequences 9606.ENSP00000308310 ENSP00000308310 ENSP00000383492 ENSP00000393674 ENSP00000403025 ENSP00000416663 gi|20162564|ref|NP_619645.1| ENSP00000308310 ENSP00000383492 ENSP00000393674 ENSP00000403025 ENSP00000416663 NP_619645.1.87134 NP_619645.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]