SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403198 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403198
Domain Number 1 Region: 43-203
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 5.75e-68
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403198   Gene: ENSG00000131236   Transcript: ENST00000421589
Sequence length 203
Comment pep:known chromosome:GRCh38:1:40040583:40066300:1 gene:ENSG00000131236 transcript:ENST00000421589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTT
Download sequence
Identical sequences A0A2J8LYT1 Q5T0R3
ENSP00000403198 ENSP00000403198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]