SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403351 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403351
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily Globin-like 1.72e-37
Family Globins 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403351   Gene: ENSG00000198125   Transcript: ENST00000443033
Sequence length 143
Comment pep:known chromosome:GRCh38:22:35607333:35623401:-1 gene:ENSG00000198125 transcript:ENST00000443033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDM
Download sequence
Identical sequences B0QYF8
ENSP00000403351 ENSP00000403351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]