SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000403714 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403714
Domain Number 1 Region: 102-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.26e-16
Family LIM domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSP00000403714
Domain Number - Region: 55-107
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.013
Family Cytochrome c3-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403714   Gene: ENSG00000159840   Transcript: ENST00000446634
Sequence length 171
Comment pep:putative chromosome:GRCh38:7:143383000:143388896:1 gene:ENSG00000159840 transcript:ENST00000446634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTYTRTQHRKKCQGPVSFAESWAAQQQAGRVRSPGAPGPLTLKEVEELEQLTQQLMQDM
EHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGA
PYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTS
Download sequence
Identical sequences C9JJK5
ENSP00000403714 ENSP00000403714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]