SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404291 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404291
Domain Number 1 Region: 20-422
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.05e-104
Family Integrin alpha N-terminal domain 0.000000000000169
Further Details:      
 
Domain Number 2 Region: 723-951
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-68
Family Integrin domains 0.00000000137
Further Details:      
 
Domain Number 3 Region: 423-582
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-46
Family Integrin domains 0.0000000284
Further Details:      
 
Domain Number 4 Region: 583-715
Classification Level Classification E-value
Superfamily Integrin domains 1.36e-36
Family Integrin domains 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404291   Gene: ENSG00000138448   Transcript: ENST00000433736
Sequence length 1002
Comment pep:known chromosome:GRCh38:2:186600205:186677441:1 gene:ENSG00000138448 transcript:ENST00000433736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGTLLLILYILMLCRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATG
NRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKT
VEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYD
PNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIY
DGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVS
VSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIF
NGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYR
ARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVE
LLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPIT
IFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKK
IYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQT
RQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDL
AVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLH
LQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHL
ITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNH
SYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLL
LLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Download sequence
Identical sequences ENSP00000404291 ENSP00000404291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]