SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404426 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404426
Domain Number 1 Region: 136-293
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.59e-23
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.017
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000556
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404426   Gene: ENSG00000154719   Transcript: ENST00000419219
Sequence length 297
Comment pep:putative chromosome:GRCh38:21:25592812:25607484:-1 gene:ENSG00000154719 transcript:ENST00000419219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALAMGSRALRLWLVAPGGGIKWRFIATSSASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDCDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVLDSKLD
EWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASQNPER
IVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLR
Download sequence
Identical sequences C9JG87
ENSP00000404426 ENSP00000404426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]