SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404847 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404847
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.26e-51
Family Proteasome subunits 0.000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404847   Gene: ENSG00000239836   Transcript: ENST00000420182
Sequence length 196
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:32997896:33013346:1 gene:ENSG00000239836 transcript:ENST00000420182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQL
ELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQP
FAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGV
DHRVILGNELPKFYDE
Download sequence
Identical sequences A0A2J8NYE0 A2ACR1
ENSP00000378739 ENSP00000382305 ENSP00000382516 ENSP00000401221 ENSP00000404847 ENSP00000378739 ENSP00000382305 ENSP00000382516 ENSP00000401221 ENSP00000404847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]