SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405439 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405439
Domain Number 1 Region: 37-150
Classification Level Classification E-value
Superfamily Lysozyme-like 4.69e-19
Family G-type lysozyme 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405439   Gene: ENSG00000185674   Transcript: ENST00000423306
Sequence length 169
Comment pep:known chromosome:GRCh38:2:99244010:99255282:-1 gene:ENSG00000185674 transcript:ENST00000423306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVA
Download sequence
Identical sequences C9JBA4
ENSP00000405439 ENSP00000405439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]