SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405442 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405442
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000000000000068
Family Sec7 domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSP00000405442
Domain Number - Region: 14-49
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.00523
Family AF0060-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405442   Gene: ENSG00000100055   Transcript: ENST00000457992
Sequence length 117
Comment pep:known chromosome:GRCh38:22:37282027:37297682:1 gene:ENSG00000100055 transcript:ENST00000457992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGE
Download sequence
Identical sequences B1AHH4
ENSP00000405442 ENSP00000405442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]