SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405669 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405669
Domain Number 1 Region: 199-488,597-639
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-70
Family FAD-linked reductases, N-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 473-587
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Domain Number 3 Region: 89-195
Classification Level Classification E-value
Superfamily Homeodomain-like 3.31e-20
Family SWIRM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405669   Gene: ENSG00000165097   Transcript: ENST00000449850
Sequence length 640
Comment pep:known chromosome:GRCh38:6:18185788:18222115:1 gene:ENSG00000165097 transcript:ENST00000449850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAAT
GNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRD
PTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLIN
TGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWD
DKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRM
DFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNL
EYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPQVQCID
YSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKI
ALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVR
TLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDII
AEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences H0Y6H0
ENSP00000405669 ENSP00000405669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]