SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405845 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405845
Domain Number 1 Region: 28-116
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.22e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405845   Gene: ENSG00000086598   Transcript: ENST00000438031
Sequence length 166
Comment pep:putative chromosome:GRCh38:12:123584533:123590446:1 gene:ENSG00000086598 transcript:ENST00000438031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQD
METEGGGDTWDAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHR
Download sequence
Identical sequences A0A2J8MCQ5 A0A2J8XJ36 E7EQ72
ENSP00000405845 ENSP00000405845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]