SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405865 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000405865
Domain Number - Region: 42-70
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0497
Family Integrin alpha N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405865   Gene: ENSG00000161638   Transcript: ENST00000435631
Sequence length 137
Comment pep:known chromosome:GRCh38:12:54404771:54419220:-1 gene:ENSG00000161638 transcript:ENST00000435631 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGLSAPGVLTVQLRGRGACGVQVLAVVRGNSSSPWLLHLGMRSTVQLAH
REGATERPRGHLLPLHR
Download sequence
Identical sequences A0A2J8Q0X3 B4E3F4
ENSP00000405865 ENSP00000405865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]