SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406101 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000406101
Domain Number - Region: 8-50
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0366
Family Rhomboid-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406101   Gene: ENSG00000157036   Transcript: ENST00000447573
Sequence length 56
Comment pep:known chromosome:GRCh38:3:38496343:38524818:1 gene:ENSG00000157036 transcript:ENST00000447573 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAIKSIASRLRGSRRFLSGFVAGAVVGAAGAGLAALQFFRSQGAEGALTGKQPDDC
Download sequence
Identical sequences A0A2I2Y766 A0A2I3SE42 F2Z2D3
ENSP00000400239 ENSP00000406101 ENSP00000407641 ENSP00000412841 ENSP00000400239 ENSP00000406101 ENSP00000407641 ENSP00000412841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]