SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406193 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406193
Domain Number 1 Region: 67-120
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000395
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406193   Gene: ENSG00000243156   Transcript: ENST00000424046
Sequence length 125
Comment pep:putative chromosome:GRCh38:22:17904728:18001180:-1 gene:ENSG00000243156 transcript:ENST00000424046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKHETMNPAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNN
Download sequence
Identical sequences C9J922
ENSP00000406193 ENSP00000406193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]