SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406397 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406397
Domain Number 1 Region: 56-167
Classification Level Classification E-value
Superfamily Rhomboid-like 2.22e-22
Family Rhomboid-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406397   Gene: ENSG00000007384   Transcript: ENST00000448893
Sequence length 232
Comment pep:novel chromosome:GRCh38:16:58137:59762:-1 gene:ENSG00000007384 transcript:ENST00000448893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRPCCIGTKGRCEITSREYCDFMRGYFHEEATLCSQVHCMDDVCGLLPFLNPEMTVLRDL
EKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILAR
PWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFDLYRKRCQ
IIIFQVVFLGLLAGLVVLFYVYPVRCEWCEFLTCIPFTDKFCEKYELDAQLH
Download sequence
Identical sequences H0Y6L9
ENSP00000406397 ENSP00000406397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]