SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406611 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406611
Domain Number 1 Region: 76-143
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.09e-18
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406611   Gene: ENSG00000011376   Transcript: ENST00000431023
Sequence length 144
Comment pep:novel chromosome:GRCh38:3:45388564:45446935:1 gene:ENSG00000011376 transcript:ENST00000431023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVWQRLGFYASLLKRQLNGGPDVIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVE
KWWHQRIKEQASKISEADVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQLDR
LGLCFSWDREITTCLPDYYKWTQY
Download sequence
Identical sequences C9IZR7
ENSP00000406611 ENSP00000406611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]