SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406670 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406670
Domain Number 1 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 4.18e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSP00000406670
Domain Number - Region: 118-165
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000384
Family cAMP-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406670   Gene: ENSG00000188191   Transcript: ENST00000417852
Sequence length 165
Comment pep:known chromosome:GRCh38:7:607396:727341:-1 gene:ENSG00000188191 transcript:ENST00000417852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVI
Download sequence
Identical sequences A0A2J8IQ81 A0A2J8SR70 C9IZL8
ENSP00000406670 ENSP00000406670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]