SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407012 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407012
Domain Number 1 Region: 44-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-26
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407012   Gene: ENSG00000198453   Transcript: ENST00000427117
Sequence length 171
Comment pep:putative chromosome:GRCh38:19:36916329:36979907:1 gene:ENSG00000198453 transcript:ENST00000427117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
PRRGENCCASEVMAEMEFCPCCPGWSAMARSQLTATSASRVEVILLPQPPE
Download sequence
Identical sequences C9JZ58
ENSP00000407012 ENSP00000407012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]