SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407345 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407345
Domain Number 1 Region: 29-74,117-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000634
Family Tandem AAA-ATPase domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407345   Gene: ENSG00000117597   Transcript: ENST00000457820
Sequence length 248
Comment pep:known chromosome:GRCh38:1:209838805:209844632:1 gene:ENSG00000117597 transcript:ENST00000457820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCSTWSFLAPLPQQFHLKILFLPLTPLRLLLLSAQVLIVVPFREAALRVVQLFISLLEGD
SKKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDYEAVFVGNIDDHFRIGVAILQRSIRLY
APFYSSDILIASPLGLRTIIGGEGEKKRDFDFLSSIELLIIDQADIYLMQNWEHVLHLMN
HMNLLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVGS
RLVSSVSS
Download sequence
Identical sequences H7C2R4
ENSP00000407345 ENSP00000407345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]