SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407787 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000407787
Domain Number - Region: 66-124
Classification Level Classification E-value
Superfamily ARM repeat 0.000326
Family Plakophilin 1 helical region 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407787   Gene: ENSG00000149262   Transcript: ENST00000433818
Sequence length 132
Comment pep:known chromosome:GRCh38:11:77878720:77994671:-1 gene:ENSG00000149262 transcript:ENST00000433818 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFA
RKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQN
ETSDRYVSWCKK
Download sequence
Identical sequences A0A2J8MBK5 A0A2J8V0R3 F8WAA7
ENSP00000407787 ENSP00000407787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]