SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408125 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408125
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.66e-22
Family Ubiquitin-related 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408125   Gene: ENSG00000228760   Transcript: ENST00000427281
Sequence length 197
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:31687241:31691432:-1 gene:ENSG00000228760 transcript:ENST00000427281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGPQPQHSQPP
Download sequence
Identical sequences F6UR09
ENSP00000388388 ENSP00000391693 ENSP00000405371 ENSP00000406436 ENSP00000407668 ENSP00000408125 ENSP00000411412 ENSP00000388388 ENSP00000391693 ENSP00000405371 ENSP00000406436 ENSP00000407668 ENSP00000408125 ENSP00000411412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]