SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408236 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408236
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 1.11e-78
Family Sec7 domain 0.00000000469
Further Details:      
 
Domain Number 2 Region: 259-376
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-35
Family Pleckstrin-homology domain (PH domain) 0.000000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408236   Gene: ENSG00000105443   Transcript: ENST00000452733
Sequence length 399
Comment pep:known chromosome:GRCh38:19:48469032:48479388:1 gene:ENSG00000105443 transcript:ENST00000452733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQ
EEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Download sequence
Identical sequences A0A1S3AKA4 A0A1S3G3T7 A0A2K5L7X5 A0A2K5VFQ8 A0A2K6DVZ4 A0A2K6K5R2 A0A2K6RVA6 B7TJ09 G3RCA7 H0XWA4 H2NZG5 H9Z0F7 K7AXC7 L9J9H7 Q76MY7
ENSGGOP00000013131 ENSMMUP00000002385 ENSPPYP00000011406 ENSP00000408236 ENSGGOP00000013131 ENSMMUP00000002385 NP_001135984.1.54773 NP_001135984.1.66739 NP_004219.3.87134 NP_004219.3.92137 XP_002829550.3.23681 XP_003406879.1.64505 XP_003801573.1.62490 XP_004061137.1.27298 XP_004381748.1.4749 XP_004440280.1.5094 XP_004451186.2.11602 XP_004694306.1.23501 XP_005336686.1.77405 XP_006160258.1.99106 XP_006208562.1.17985 XP_007536293.1.11023 XP_010366959.1.97406 XP_010813410.1.76553 XP_010990006.1.51371 XP_012883325.1.60039 XP_015352094.1.40921 XP_015977971.1.101085 XP_016061596.1.3490 XP_016791911.1.37143 XP_017918196.1.57651 XP_019597103.1.88060 XP_020743837.1.74333 ENSOGAP00000020397 9544.ENSMMUP00000002385 9600.ENSPPYP00000011406 9606.ENSP00000408236 ENSETEP00000011947 ENSNLEP00000005467 ENSP00000408236 ENSSSCP00000003394 ENSSTOP00000000243 ENSSTOP00000000243 ENSETEP00000011947 ENSSSCP00000003394 ENSPPYP00000011406 gi|195972859|ref|NP_004219.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]