SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408334 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000408334
Domain Number - Region: 47-106
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0011
Family SNARE fusion complex 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408334   Gene: ENSG00000138443   Transcript: ENST00000431886
Sequence length 108
Comment pep:known chromosome:GRCh38:2:203328399:203380277:1 gene:ENSG00000138443 transcript:ENST00000431886 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS
VAYLINTLANNVLQMLDIQASQLRRMESSINHISQMFSHTDGQLTEAN
Download sequence
Identical sequences A0A2J8N5J0 A0A2J8WUP7 F8WEB9
ENSP00000408334 ENSP00000408334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]