SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408559 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408559
Domain Number 1 Region: 71-190
Classification Level Classification E-value
Superfamily PABC (PABP) domain 6.41e-47
Family PABC (PABP) domain 0.00000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408559   Gene: ENSG00000090621   Transcript: ENST00000437136
Sequence length 195
Comment pep:putative chromosome:GRCh38:1:39560816:39564491:-1 gene:ENSG00000090621 transcript:ENST00000437136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRHLAPTGNAPASRGLPTTTQRVGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQN
LAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQ
EQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQA
HHAKKEAAQKDSKAK
Download sequence
Identical sequences H0Y6X6
ENSP00000408559 ENSP00000408559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]