SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408626 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000408626
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0373
Family Pyridoxal-dependent decarboxylase 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408626   Gene: ENSG00000132437   Transcript: ENST00000420203
Sequence length 31
Comment pep:known chromosome:GRCh38:7:50543994:50564334:-1 gene:ENSG00000132437 transcript:ENST00000420203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYP
Download sequence
Identical sequences ENSP00000408626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]