SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408741 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408741
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 2.61e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 379-481
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-24
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 3 Region: 644-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000366
Family Integrin beta tail domain 0.0092
Further Details:      
 
Domain Number 4 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000194
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 602-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family Integrin beta EGF-like domains 0.0061
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSP00000408741
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408741   Gene: ENSG00000139626   Transcript: ENST00000422257
Sequence length 798
Comment pep:known chromosome:GRCh38:12:53191323:53207282:-1 gene:ENSG00000139626 transcript:ENST00000422257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
Download sequence
Identical sequences P26010
ENSP00000267082 9606.ENSP00000267082 gi|4504777|ref|NP_000880.1| ENSP00000267082 ENSP00000408741 ENSP00000267082 ENSP00000408741 NP_000880.1.87134 NP_000880.1.92137 XP_005268908.1.92137 XP_005268909.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]