SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408858 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408858
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.71e-41
Family Phosphofructokinase 0.0001
Further Details:      
 
Domain Number 2 Region: 132-240
Classification Level Classification E-value
Superfamily Phosphofructokinase 5.62e-19
Family Phosphofructokinase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408858   Gene: ENSG00000067057   Transcript: ENST00000415005
Sequence length 240
Comment pep:putative chromosome:GRCh38:10:3104724:3113516:1 gene:ENSG00000067057 transcript:ENST00000415005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAI
DTQNKPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEA
TPDTPACVVSLNGNHAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKR
LAIKLPDDQIPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKG
Download sequence
Identical sequences A0A2J8KTY6 A0A2J8S2Y0 B1APP6
ENSP00000408858 ENSP00000408858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]