SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409377 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000409377
Domain Number - Region: 107-148
Classification Level Classification E-value
Superfamily Integrin domains 0.0575
Family Integrin domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409377   Gene: ENSG00000005844   Transcript: ENST00000433423
Sequence length 404
Comment pep:novel chromosome:GRCh38:16:30472751:30521779:1 gene:ENSG00000005844 transcript:ENST00000433423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQIKSLIPQFQ
GRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPMMFNTLVNS
SWGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKI
HQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERL
PDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFH
LYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKME
AGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD
Download sequence
Identical sequences B4E021
ENSP00000409377 ENSP00000409377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]