SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409446 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409446
Domain Number 1 Region: 19-168
Classification Level Classification E-value
Superfamily Cupredoxins 3.01e-45
Family Multidomain cupredoxins 0.000034
Further Details:      
 
Domain Number 2 Region: 151-221
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000141
Family Multidomain cupredoxins 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409446   Gene: ENSG00000185010   Transcript: ENST00000423959
Sequence length 222
Comment pep:putative chromosome:GRCh38:X:154984701:155026940:-1 gene:ENSG00000185010 transcript:ENST00000423959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRDARAQKASRGFPPRVPKSFPFNTSVVYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTI
QAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTY
VWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFI
LLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYV
Download sequence
Identical sequences B1B0G8
ENSP00000409446 ENSP00000409446 ENSP00000469822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]