SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 76_38 > ENSP00000409457

Domain assignment for ENSP00000409457 from Homo sapiens 76_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000409457
Domain Number 1	Region: 240-309
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	1.08e-16
Family	I set domains	0.031
Further Details:

Domain Number 2	Region: 22-117
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.000000000000187
Family	I set domains	0.027
Further Details:

Domain Number 3	Region: 143-210
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000052
Family	C2 set domains	0.077
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000409457 Gene: ENSG00000229058 Transcript: ENST00000456918
Sequence length	404
Comment	pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:32220356:32223712:-1 gene:ENSG00000229058 transcript:ENST00000456918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
Download sequence
Identical sequences	A0A1U9X785 Q15109 gi\|10835203\|ref\|NP_001127.1\| NP_001127.1.87134 NP_001127.1.92137 ENSP00000364217 ENSP00000395812 ENSP00000397227 ENSP00000401068 ENSP00000409457 ENSP00000364217 ENSP00000395812 ENSP00000397227 ENSP00000401068 ENSP00000409457 NYSGRC-IgSF-RAGE_HUMAN hsi002012890.1 9606.ENSP00000364217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]