SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409718 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409718
Domain Number 1 Region: 76-297
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.61e-67
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 342-481
Classification Level Classification E-value
Superfamily Nudix 1.04e-29
Family MutY C-terminal domain-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409718   Gene: ENSG00000132781   Transcript: ENST00000448481
Sequence length 532
Comment pep:known chromosome:GRCh38:1:45329242:45339935:-1 gene:ENSG00000132781 transcript:ENST00000448481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGMIAECPGAPAGLARQPEEVVL
QASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVSEVML
QQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEEL
GGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTL
VSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQEQL
LASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREESSATCVL
EQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPATHLR
HLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKVFRVY
QGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
Download sequence
Identical sequences ENSP00000361172 ENSP00000409718 NP_001280120.1.87134 NP_001280120.1.92137 XP_011539806.1.92137 ENSP00000409718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]