SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410084 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410084
Domain Number 1 Region: 29-134
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000184
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410084   Gene: ENSG00000183054   Transcript: ENST00000446930
Sequence length 135
Comment pep:putative chromosome:GRCh38:2:110563331:110577185:-1 gene:ENSG00000183054 transcript:ENST00000446930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSKADVERYVASVLGLTPSPRQSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPK
AHRFLGLLYELEENTEKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERA
AKLFPGSPAIYKLKE
Download sequence
Identical sequences C9JF75
ENSP00000410084 ENSP00000410084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]