SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410310 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410310
Domain Number 1 Region: 466-822
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.82e-111
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 279-461
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 110-292
Classification Level Classification E-value
Superfamily GAF domain-like 1e-33
Family GAF domain 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410310   Gene: ENSG00000186642   Transcript: ENST00000418754
Sequence length 826
Comment pep:novel chromosome:GRCh38:11:72577211:72674408:-1 gene:ENSG00000186642 transcript:ENST00000418754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQVHCGQLSDNEEW
SLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCG
ELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGC
LGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEG
DLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQ
EIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQI
LNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDED
LATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAA
IDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPY
HNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVL
AALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLR
IFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGD
LEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHW
TKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences A0A2I3S5F1 E9PEF1
ENSP00000410310 ENSP00000410310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]