SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410642 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410642
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily TPR-like 0.000000105
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410642   Gene: ENSG00000018699   Transcript: ENST00000433416
Sequence length 100
Comment pep:known chromosome:GRCh38:2:32736785:32787149:1 gene:ENSG00000018699 transcript:ENST00000433416 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XCYERAGQHGKAEEILRQELEKKETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSK
ALLHLRNKEFQECVECFERSVKINPMQGSGRPEEREKIGE
Download sequence
Identical sequences H7C3A3
ENSP00000410642 ENSP00000410642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]