SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410747 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410747
Domain Number 1 Region: 43-151
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-28
Family Arfaptin, Rac-binding fragment 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410747   Gene: ENSG00000163596   Transcript: ENST00000450143
Sequence length 151
Comment pep:known chromosome:GRCh38:2:202819807:202871046:-1 gene:ENSG00000163596 transcript:ENST00000450143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQ
ETCTELLKIIEKYQLRLNVISEEENELGLFLKFQAERDATQAGKMMDATGKALCSSAKQR
LALCTPLSRLKQEVATFSQRAVSDTLMTINR
Download sequence
Identical sequences ENSP00000410747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]