SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410895 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410895
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.11e-28
Family Pancreatic carboxypeptidases 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410895   Gene: ENSG00000120054   Transcript: ENST00000441382
Sequence length 204
Comment pep:known chromosome:GRCh38:10:100048767:100065394:-1 gene:ENSG00000120054 transcript:ENST00000441382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHG
WMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQRE
WLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPG
IYTVSATAPGYDPETVTVTVGPAE
Download sequence
Identical sequences B1AP58
ENSP00000410895 ENSP00000410895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]