SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411007 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411007
Domain Number 1 Region: 33-301
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.34e-76
Family Thioesterases 0.000000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411007   Gene: ENSG00000231618   Transcript: ENST00000424353
Sequence length 302
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MCF_CTG1:32230517:32240106:1 gene:ENSG00000231618 transcript:ENST00000424353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRAL
LSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWH
DPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPW
LS
Download sequence
Identical sequences A0A024RCQ8 A0A2K5MK18
1pja_A ENSP00000382748 ENSP00000382749 ENSP00000382750 ENSP00000388341 ENSP00000389930 ENSP00000392885 ENSP00000395242 ENSP00000399879 ENSP00000403820 ENSP00000406496 ENSP00000406566 ENSP00000408703 ENSP00000411007 ENSP00000411625 ENSP00000412827 ENSP00000433696 ENSP00000447926 ENSP00000447950 ENSP00000447973 ENSP00000448392 ENSP00000448877 1pjaA XP_010376517.1.97406 XP_011890016.1.92194 ENSP00000382748 ENSP00000382749 ENSP00000382750 ENSP00000388341 ENSP00000389930 ENSP00000392885 ENSP00000395242 ENSP00000399879 ENSP00000403820 ENSP00000406496 ENSP00000406566 ENSP00000408703 ENSP00000411007 ENSP00000411625 ENSP00000412827 ENSP00000433696 ENSP00000447926 ENSP00000447950 ENSP00000447973 ENSP00000448392 ENSP00000448877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]