SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411378 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411378
Domain Number 1 Region: 181-264
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.53e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.00000437
Further Details:      
 
Domain Number 2 Region: 91-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000678
Family Glutathione S-transferase (GST), N-terminal domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411378   Gene: ENSG00000148334   Transcript: ENST00000449878
Sequence length 265
Comment pep:novel chromosome:GRCh38:9:128122466:128127724:-1 gene:ENSG00000148334 transcript:ENST00000449878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQVVEVNPVRRAEIKFSSYRKVPILVAQE
GESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNE
KEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEG
AVAKYMGAAAMYLISKRLKSRHRLQ
Download sequence
Identical sequences A0A2J8NBF9 X6RJ95
ENSP00000411378 ENSP00000411378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]