SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411405 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000411405
Domain Number - Region: 5-38
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.000174
Family D-ribulose-5-phosphate 3-epimerase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411405   Gene: ENSG00000197713   Transcript: ENST00000438191
Sequence length 60
Comment pep:known chromosome:GRCh38:2:210002650:210016558:1 gene:ENSG00000197713 transcript:ENST00000438191 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDAPCSSGRSVFCILFPTSPLVTLW
Download sequence
Identical sequences A0A2J8N615 A0A2J8XT21 F8WBT4
ENSP00000411405 ENSP00000411405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]