SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411432 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411432
Domain Number 1 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000000301
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411432   Gene: ENSG00000114302   Transcript: ENST00000419216
Sequence length 114
Comment pep:putative chromosome:GRCh38:3:48790599:48847833:-1 gene:ENSG00000114302 transcript:ENST00000419216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVCAETYNPDEEEEDTDPRVIHPKTDEQ
Download sequence
Identical sequences C9J830
ENSP00000411432 ENSP00000411432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]