SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411434 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411434
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000176
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411434   Gene: ENSG00000182177   Transcript: ENST00000447030
Sequence length 148
Comment pep:putative chromosome:GRCh38:2:236196058:236214601:-1 gene:ENSG00000182177 transcript:ENST00000447030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARDEDERSPLHKACGHASHSLARLLLRHGADAGALDYGGASPLGRVLQTASCALQASPQR
TVQALLNHGSPTVWPDAFPKVLKTCASVPAVIEVLFNSYPQLCLSESWKEVIPEEVFQAR
GLPFCPSLVQNFCLFLLLCMGSFALIFG
Download sequence
Identical sequences H7C3E8
ENSP00000411434 ENSP00000411434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]