SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411538 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411538
Domain Number 1 Region: 40-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-53
Family Tandem AAA-ATPase domain 0.0000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411538   Gene: ENSG00000215425   Transcript: ENST00000415027
Sequence length 231
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:31525675:31532200:-1 gene:ENSG00000215425 transcript:ENST00000415027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI
VDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMC
HTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA
RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATL
Download sequence
Identical sequences A0A2J8NXR0 A0A2J8R4X3 F6S4E6
ENSP00000390562 ENSP00000392922 ENSP00000404735 ENSP00000406504 ENSP00000411538 ENSP00000414984 ENSP00000416350 ENSP00000390562 ENSP00000392922 ENSP00000404735 ENSP00000406504 ENSP00000411538 ENSP00000414984 ENSP00000416350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]