SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411606 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411606
Domain Number 1 Region: 31-156
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.65e-36
Family Myeloperoxidase-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411606   Gene: ENSG00000095303   Transcript: ENST00000426608
Sequence length 156
Comment pep:known chromosome:GRCh38:9:122371188:122383532:1 gene:ENSG00000095303 transcript:ENST00000426608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLLWFLLFLLLLPPLPVLLADPGAPTPAGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFV
NATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNFFKTSGKMGPGFTKALGHG
VDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYP
Download sequence
Identical sequences X6RJD6
ENSP00000411606 ENSP00000411606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]