SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411657 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411657
Domain Number 1 Region: 560-916
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.26e-110
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 373-555
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 204-386
Classification Level Classification E-value
Superfamily GAF domain-like 1.2e-33
Family GAF domain 0.0000000179
Further Details:      
 
Domain Number 4 Region: 22-176
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000285
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411657   Gene: ENSG00000186642   Transcript: ENST00000444035
Sequence length 920
Comment pep:known chromosome:GRCh38:11:72576142:72642460:-1 gene:ENSG00000186642 transcript:ENST00000444035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQPAASLDPLAKEPGPPGSRDDRLEDALLSLGSVIDISGLQRAVKEALSAVLPRVETV
YTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDLPGKPLARLVAPLAP
DTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPRE
APRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASR
CCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSEDVQQLQS
MLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTL
AFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELV
AKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRN
ILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQ
YRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILS
MLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYL
EDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTH
GCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLC
LLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQIS
FMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE
VPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences A0A2I3RC52
ENSP00000411657 NP_001230713.1.87134 NP_001230713.1.92137 XP_003815719.1.60992 XP_008966885.1.60992 XP_009421991.2.37143 XP_508624.4.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]