SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412045 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412045
Domain Number 1 Region: 160-544
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000991
Further Details:      
 
Domain Number 2 Region: 521-646
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.72e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000242
Further Details:      
 
Domain Number 3 Region: 59-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.13e-16
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412045   Gene: ENSG00000198431   Transcript: ENST00000429002
Sequence length 651
Comment pep:known chromosome:GRCh38:12:104215779:104350305:1 gene:ENSG00000198431 transcript:ENST00000429002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKA
RLLEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNY
GWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNK
GKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECA
GFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGR
LRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNV
PYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLS
EEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAG
EVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC
Download sequence
Identical sequences 9606.ENSP00000412045 ENSP00000412045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]