SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412581 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000412581
Domain Number - Region: 9-45
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0445
Family Integrin alpha N-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412581   Gene: ENSG00000167930   Transcript: ENST00000421000
Sequence length 234
Comment pep:putative chromosome:GRCh38:16:254628:260788:1 gene:ENSG00000167930 transcript:ENST00000421000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPDRPASQRMWRIDYSAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNNFSRSCVDEGFS
SPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVGRPSSFIAVNLF
TGAVRCHLPWGSREEERLGPRLLLGCQWWQCPGRAQNMNQHSARQGRSGPVSAPKPEGAG
LRAPAEPASWKDEGKNAWCTGPCVCVGSLHLIAVWKISVPRFGECSYFPYKLSF
Download sequence
Identical sequences H7C3L6
ENSP00000412581 ENSP00000412581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]