SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412637 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412637
Domain Number 1 Region: 179-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000379
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 
Domain Number 2 Region: 123-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000686
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412637   Gene: ENSG00000131732   Transcript: ENST00000438268
Sequence length 271
Comment pep:known chromosome:GRCh38:5:81301641:81312662:1 gene:ENSG00000131732 transcript:ENST00000438268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWARVSTTYNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKK
NKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKR
QAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGE
FPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGR
WAKGMSADYEEILDVPKPQKPKTKIPKVVNF
Download sequence
Identical sequences A0A024RAL5 G3RD57 Q8N567
ENSGGOP00000013453 NP_001124507.1.87134 NP_001124507.1.92137 NP_001124508.1.87134 NP_001124508.1.92137 NP_115656.1.87134 NP_115656.1.92137 XP_004042275.1.27298 XP_004042276.1.27298 ENSP00000254037 ENSP00000369546 ENSP00000385047 ENSP00000412637 ENSP00000254037 ENSP00000369546 ENSP00000385047 ENSP00000412637 gi|14150027|ref|NP_115656.1| gi|196259803|ref|NP_001124507.1| gi|196259805|ref|NP_001124508.1| 9606.ENSP00000254037 ENSP00000254037 ENSGGOP00000013453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]