SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412899 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412899
Domain Number 1 Region: 35-85
Classification Level Classification E-value
Superfamily EF-hand 0.000000000366
Family Penta-EF-hand proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412899   Gene: ENSG00000115271   Transcript: ENST00000429691
Sequence length 87
Comment pep:putative chromosome:GRCh38:2:162319034:162361098:1 gene:ENSG00000115271 transcript:ENST00000429691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQ
SGINGTYSPFSLETCRIMIAMLDRKET
Download sequence
Identical sequences C9JV47
ENSP00000412899 ENSP00000412899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]